PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 174aa    MW: 20243.8 Da    PI: 6.6384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592760.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.13.2e-11246244
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      +WT +Ed+l+ +a  +++ +   +W +Ia +++ g+t ++++ ++
   XP_009592760.1  2 SKWTRDEDKLFEHALVLYPENiadRWQLIADHVP-GKTTEDIIAHY 46
                     58********************************.**********9 PP

2Myb_DNA-binding47.15.6e-1587131347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_009592760.1  87 PWTEEEHRLFLIGLEKYGKGDWRSISRNVVVTRTPTQVASHAQKY 131
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.347154IPR017930Myb domain
SMARTSM007172.3E-6152IPR001005SANT/Myb domain
SuperFamilySSF466896.63E-12257IPR009057Homeodomain-like
PfamPF002498.9E-10347IPR001005SANT/Myb domain
CDDcd001672.20E-9346No hitNo description
Gene3DG3DSA:1.10.10.606.7E-6349IPR009057Homeodomain-like
PROSITE profilePS5129422.67380136IPR017930Myb domain
SuperFamilySSF466891.52E-1782136IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-1883135IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.4E-1284130IPR009057Homeodomain-like
SMARTSM007174.4E-1284134IPR001005SANT/Myb domain
CDDcd001674.09E-1087132No hitNo description
PfamPF002496.5E-1387131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSKWTRDEDK LFEHALVLYP ENIADRWQLI ADHVPGKTTE DIIAHYDDLV HDLLEIDSGR  60
IELPAYTDDP VESNKKNIEI ERKKGTPWTE EEHRLFLIGL EKYGKGDWRS ISRNVVVTRT  120
PTQVASHAQK YFIRQQAMKK ERKRSSIHDI TTAVDTNPVP PQSSFQTQRG NFTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2433391e-114AJ243339.1 Lycopersicon esculentum mRNA for I-box binding factor (LeMYBI gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592760.11e-128PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016443719.11e-128PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM1C5T11e-112M1C5T1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000604031e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-69MYB family protein